Skip to Content
BLAST
book

BLAST

by Ian Korf, Mark Yandell, Joseph Bedell
July 2003
Intermediate to advanced
368 pages
13h 44m
English
O'Reilly Media, Inc.
Content preview from BLAST
This is the Title of the Book, eMatter Edition
Copyright © 2012 O’Reilly & Associates, Inc. All rights reserved.
90
|
Chapter 6: Anatomy of a BLAST Report
values and the gap costs) because these factors control the sensitivity and speci-
ficity of a search. The footer labels these values clearly.
Alignments
The alignments and alignment statistics reported by BLAST differ slightly from pro-
gram to program. The rest of this chapter describes the details of BLASTP, BLASTN,
BLASTX, TBLASTN, and TBLASTX alignments and shows how to recognize align-
ment groups.
BLASTP
BLASTP alignments are the simplest to understand. Figure 6-2 shows the anatomy of
a typical BLASTP alignment.
Here are the parts you should pay attention to:
Score
This value is computed from the scoring matrix and gap penalties. A higher
score indicates greater similarity. The raw score is shown without units, and the
normalized score is followed by “bits.”
Database sequence
The complete FASTA definition line is reported here along with the length of the
sequence. All the alignments between the query and a specific database sequence
are collectively called a hit. The database in Figure 6-2 has one alignment.
Figure 6-2. A BLASTP alignment
>gi|7428631|pir||GGGAA globin [validated] - slug sea hare
Length = 146
Score = 222 bits (566), Expect = 6e-58
Identities = 112/146 (76%), Positives = 127/146 (86%), Gaps = 2/146 (1%)
Query: 2 ALSAADAGLLAQSWAPVFANSAANGDSFLVALFTQFPESANFFNDFKGKSLADIQASPKL ...
Become an O’Reilly member and get unlimited access to this title plus top books and audiobooks from O’Reilly and nearly 200 top publishers, thousands of courses curated by job role, 150+ live events each month,
and much more.

Read now

Unlock full access

More than 5,000 organizations count on O’Reilly

AirBnbBlueOriginElectronic ArtsHomeDepotNasdaqRakutenTata Consultancy Services

QuotationMarkO’Reilly covers everything we've got, with content to help us build a world-class technology community, upgrade the capabilities and competencies of our teams, and improve overall team performance as well as their engagement.
Julian F.
Head of Cybersecurity
QuotationMarkI wanted to learn C and C++, but it didn't click for me until I picked up an O'Reilly book. When I went on the O’Reilly platform, I was astonished to find all the books there, plus live events and sandboxes so you could play around with the technology.
Addison B.
Field Engineer
QuotationMarkI’ve been on the O’Reilly platform for more than eight years. I use a couple of learning platforms, but I'm on O'Reilly more than anybody else. When you're there, you start learning. I'm never disappointed.
Amir M.
Data Platform Tech Lead
QuotationMarkI'm always learning. So when I got on to O'Reilly, I was like a kid in a candy store. There are playlists. There are answers. There's on-demand training. It's worth its weight in gold, in terms of what it allows me to do.
Mark W.
Embedded Software Engineer

You might also like

INSPIRED

INSPIRED

Marty Cagan
The Goal

The Goal

Eliyahu M. Goldratt, Jeff Cox

Publisher Resources

ISBN: 0596002998Catalog PageErrata