Skip to Content
BLAST
book

BLAST

by Ian Korf, Mark Yandell, Joseph Bedell
July 2003
Intermediate to advanced
368 pages
13h 44m
English
O'Reilly Media, Inc.
Content preview from BLAST
This is the Title of the Book, eMatter Edition
Copyright © 2012 O’Reilly & Associates, Inc. All rights reserved.
20 Tips to Improve Your BLAST Searches
|
121
8.8 Mask Repeats in Genomic DNA
As mentioned in Chapter 2, genomes may be full of repetitive elements and low-
complexity sequence. They can be very problematic in BLAST searches, and if not
masked prior to a BLAST search, will waste computer time and inflate BLAST
reports with meaningless, redundant information (Figure 8-4).
8.9 Segment Large Genomic Sequences
Nucleotide sequences can be very, very long. For example, the shortest human chro-
mosome, number 22, is over 47 million bp. BLAST wasn’t designed for large
sequences and runs poorly in such an environment. You can easily run out of mem-
ory with chromosome-sized sequences. Even if you have a computer with sufficient
memory, searching large sequences is inefficient because the procedure for assessing
combined statistical significance scales quadratically with the number of alignments.
Figure 8-3. Complexity filters (a) hard-masking and (b) soft-masking
Figure 8-4. BLASTX search with (a) repeats intact and (b) repeats masked (the alignments were
removed from the display)
a
b
Score = 70.1 bits (170), Expect = 5e-12
Identities = 35/79 (44%), Positives = 45/79 (56%)
Query: 1 MAVTQXXXXXXXXXXXXXXXXXXPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIP 60
MA TQ ++ +KSF DDLD+DSLSMVE+ V E+++ VKIP
Sbjct: 1 MAATQEEIVAGLADIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP ...
Become an O’Reilly member and get unlimited access to this title plus top books and audiobooks from O’Reilly and nearly 200 top publishers, thousands of courses curated by job role, 150+ live events each month,
and much more.

Read now

Unlock full access

More than 5,000 organizations count on O’Reilly

AirBnbBlueOriginElectronic ArtsHomeDepotNasdaqRakutenTata Consultancy Services

QuotationMarkO’Reilly covers everything we've got, with content to help us build a world-class technology community, upgrade the capabilities and competencies of our teams, and improve overall team performance as well as their engagement.
Julian F.
Head of Cybersecurity
QuotationMarkI wanted to learn C and C++, but it didn't click for me until I picked up an O'Reilly book. When I went on the O’Reilly platform, I was astonished to find all the books there, plus live events and sandboxes so you could play around with the technology.
Addison B.
Field Engineer
QuotationMarkI’ve been on the O’Reilly platform for more than eight years. I use a couple of learning platforms, but I'm on O'Reilly more than anybody else. When you're there, you start learning. I'm never disappointed.
Amir M.
Data Platform Tech Lead
QuotationMarkI'm always learning. So when I got on to O'Reilly, I was like a kid in a candy store. There are playlists. There are answers. There's on-demand training. It's worth its weight in gold, in terms of what it allows me to do.
Mark W.
Embedded Software Engineer

You might also like

INSPIRED

INSPIRED

Marty Cagan
The Goal

The Goal

Eliyahu M. Goldratt, Jeff Cox

Publisher Resources

ISBN: 0596002998Catalog PageErrata